It is currently Wed Jun 19, 2013 11:07 am

All times are UTC - 8 hours




Post new topic Reply to topic  [ 29 posts ] 
Author Message
 Post subject: Funky SPCR User Names
PostPosted: Wed Apr 07, 2004 9:00 pm 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Ok, so this doesn't have much to do with folding, but what the heck.

As I was logging off, I noticed a new user and remembered some other amusing user names. Most, like mine, are kinda boring and of course there are the confusing ones that seem to be some kind of code - like xqzw3&>f which are non-sensical and I have to cut and paste them if I want to reply with their name. :?

Anyway, a couple of my favorites are:

Beandip

Burnin' Luv

M


Top
 Profile  
 
 Post subject: Re: Funky SPCR User Names
PostPosted: Wed Apr 07, 2004 11:58 pm 
Offline
-- Vendor --

Joined: Thu Dec 04, 2003 5:35 pm
Posts: 162
Location: Rohnert Park, California, USA
mas92264 wrote:
....

Anyway, a couple of my favorites are:

Beandip

Burnin' Luv

M


Well... he's in our SPCR folding forums enough lately, he ought to just give in and start foldin' for us anyway and be done with it. :lol:

So for wackiest handle @ SPCR my nominee is ... drumroll....

Macaholic

cause he sure must be drunk on somethin' ... that's right it's pure 180 proof egohol made from fermented apples no less :lol:

But seriously folks Macaholic grows on you over time, sort of like a mole with an extra long wiry hair growing out of it... you know... gives the place some unique character don't ya think :P :wink:

Stevo
----------
Some folks said Macaholic SPCR is the place you ought'a be... So he folded up his Mac and crashed our par-ty...


Last edited by Stevo@ARM on Thu Apr 08, 2004 4:17 pm, edited 7 times in total.

Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 12:20 am 
Offline
Patron of SPCR

Joined: Fri Aug 29, 2003 11:09 pm
Posts: 2425
Location: Earth
Stevo, that's really hard to sing. ;)

There are some goofy team names too:

LITTLEWHITEDOG
Team Banana
RamblingWaffles (this pne gets my vote)
Abazaba
Alien Soup
Nerds for Jesus
Dead Men Folding
Wisconsin Wireless Wizards (very clever)
PEBCAK ID1OT


David

_________________
Join SPCR's Folding Team! <-- Click Here


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 12:38 am 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
TacoBellDog


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 12:39 am 
Offline
Patron of SPCR

Joined: Fri Aug 29, 2003 11:09 pm
Posts: 2425
Location: Earth
mas92264 wrote:
TacoBellDog

Definitely

_________________
Join SPCR's Folding Team! <-- Click Here


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 12:58 am 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Quote:
it's pure 180 proof egohol made from fermented apples no less

Very good, DH. :)

Egohol. :shock: Too funny!

M


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 8:45 am 
Offline

Joined: Mon Aug 11, 2003 5:54 pm
Posts: 542
twodeadfish

funniest I've seen a new folder for teammacosx peterhunter


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 10:01 am 
Offline
*Lifetime Patron*

Joined: Tue Aug 19, 2003 10:04 am
Posts: 327
Location: New Hampshire, USA
haysdb wrote:
There are some goofy team names too:
...
PEBCAK ID1OT


PEBCAK is one of my favorite troubleshooting acronyms from my old help-desk days: Problem Exists Between Chair And Keyboard. (Actually we had it as PEBKAC, but the "problem" stays in the same spot.) It was one we could throw at a luser and even after we expanded the acronym most of them didn't get it.

How about these teams:

CPUniCycles (A balanced approach to folding?)
Folding Anarchy (Isn't a team of anarchists an oxymoron?)
The Musers' Idle Thoughts (I think these guys are playing at Axis in Boston this weekend.)
Team Monkeys, Midgets, & Zombies (We all know the dangers of letting these three get together!)
Processor Liberation Organization (Arafat goes cyber!)
Protein Origami Masters (I think they worship Ralf Hutter.)
Box Office Prophets (They warned us about Gigli but we didn't listen.)
Czech Republic (The whole country?!?)
SystemCooling Crunchin Critters (Hmmm. Never considered the possibilities of organic CPU cooling.)
Dean For America (Maybe he should have spent more time campaigning and less time folding?)
Crowbar Swinging Idiots (The obvious solution to the Monkeys, Midgets, & Zombies problem.)
Digital Doritos (Crunch all you want, we'll fold more.)
The Flaming Chickens (Never mind the racket, that's going to smell really bad.)
Microsoft (In the 395th position? You'd think they'd either do better or sue the people who stole their name.)
Raining Squirrels (A decent rain of squirrels should put out the flaming chickens. At least we can hope.)
Pridemark Paramedics ("No, don't defibrilate him now, wait until my WU finishes!")
Milla Jovovich Fans (Uh, oh. That's gonna give GamingGod "an idea.")


Scott (obviously off my meds today)

_________________
What You Need To Know Before Buying A Discount Laptop PC
www.HowToBuyDiscountLaptopPCs.com


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 10:34 am 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Quote:
PEBCAK is one of my favorite troubleshooting acronyms from my old help-desk days: Problem Exists Between Chair And Keyboard

I'm glad to see what this means - was totally lost. My implementation of this one is "loose screw near the kybrd." I like PEBCAK better.
:)
M


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 11:45 am 
Offline

Joined: Sun Jan 18, 2004 9:57 am
Posts: 76
One of my personal favorites is:

We've got a serious 12 o'clock flasher here.... Every clock in his house is flashing 12:00.... ;)

_________________
NoahJ
TeamMacOSX (1971)
Image
Folding For the Honor Of the Platform
A True Open Source Community


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 12:48 pm 
Offline
Friend of SPCR

Joined: Mon Dec 23, 2002 12:55 pm
Posts: 1063
Location: Richland, WA
And then there's the freaks who try to avoid the common vowels in their name.

Zyzzyx

I mean, would ya look at that idiocy!

_________________
Z
________


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 2:22 pm 
Offline
*Lifetime Patron*

Joined: Sun Dec 21, 2003 11:24 am
Posts: 1734
Location: 'Sunny' Cornwall U.K.
Good point Zy, however...the ones that really get my goat.../sheep :wink: are the unimaginative ones like... bill_amer :roll:




pete_amer (friend_of_john_hooker)

folding_for_SPCR.


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 2:45 pm 
Offline

Joined: Sat Mar 06, 2004 4:24 pm
Posts: 128
Location: Dark Side of the Moon
Quote:
cause he sure must be drunk on somethin' ... that's right it's pure 180 proof egohol made from fermented apples no less


"Ye have heard that it hath been said, An eye for an eye, and a
tooth for a tooth:

But I say unto you, That ye resist not evil: but whosoever
shall smite thee on thy right cheek, turn to him the other
also.

And if any man will sue thee at the law, and take away thy
coat, let him have thy cloak also.

And whosoever shall compel thee to go a mile, go with him
twain."

_________________
hello. AGAIN

157.58 GHz Tower of Folding Power
13th Ranked Folder in the World
Team MacOS X - As seen on Apple.com


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 3:00 pm 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Quote:
We've got a serious 12 o'clock flasher here.... Every clock in his house is flashing 12:00....

Or the similar and equally descriptive "some of her dogs aren't barking."

M


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 3:49 pm 
Offline
-- Vendor --

Joined: Thu Dec 04, 2003 5:35 pm
Posts: 162
Location: Rohnert Park, California, USA
Macaholic wrote:

"Ye have heard that it hath been said, An eye for an eye, and a
tooth for a tooth:

But I say unto you, That ye resist not evil: but whosoever
shall smite thee on thy right cheek, turn to him the other
also.

And if any man will sue thee at the law, and take away thy
coat, let him have thy cloak also.

And whosoever shall compel thee to go a mile, go with him
twain."


Excellent comeback Macaholic :wink: Now you should know, I am certainly not going to argue with the good book. :lol:

"a soft answer turneth away wrath"

And hey, we've been having fun swapping jabs lately, but for what it's worth, you and NoahJ and your other team members have all made folding a heck of a lot more exciting for both Roy and myself and many of our fellow SPCR team members as well. I hope we have put a bit more fun into your folding efforts too.

As for our friendly cross-town rivalry our teams will will certainly play again just a little later in the season. Your current massive new membership influx has put you guys into hyper-space. We will continue building the team one solid loyal folder at a time though, and at some point when your warp engines need some refueling we'll certainly be there to liven things up again for the playoffs.

I tip my hat to you and NoahJ and everyone else at Team MacOS X. For though we may be friendly competitors, I must say I am truly impressed with both your personal folding points production, and the awesome PR job NoahJ put together with Apple that pushed your team into Warp-drive.

Goals are a good thing, and I am actually glad your team has raised the bar so high. Our team needs to build up some more folding muscle and your team's recent achievements have proven just what can be accomplished.

Stevo
--------------
Fold on Macaholic, 'cause this folding gorilla is going to eat some more bananas to bulk up before our next game :wink:


Last edited by Stevo@ARM on Thu Apr 08, 2004 8:11 pm, edited 4 times in total.

Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 4:26 pm 
Offline

Joined: Sun Jan 18, 2004 9:57 am
Posts: 76
Thanks Stevo! If we meet again it should be in the top 15 playoffs.. Maybe even the top 10.... :D

_________________
NoahJ
TeamMacOSX (1971)
Image
Folding For the Honor Of the Platform
A True Open Source Community


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 4:27 pm 
Offline

Joined: Mon Aug 11, 2003 5:54 pm
Posts: 542
That reminds me there is also this team name

http://folding.extremeoverclocking.com/ ... s=&t=11195


Top
 Profile  
 
 Post subject:
PostPosted: Thu Apr 08, 2004 11:58 pm 
Offline
-- Vendor --

Joined: Thu Dec 04, 2003 5:35 pm
Posts: 162
Location: Rohnert Park, California, USA
haysdb wrote:
There are some goofy team names too....


Add this one to the list:

Departamento de Informática da Faculdade de Ciências da Universidade de Lisboa

In about 600th place at the moment
http://folding.extremeoverclocking.com/team_summary.php?s=&t=34093

Stevo
-------------
And you thought I had a long team name :lol:


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 12:33 am 
Offline
Patron of SPCR

Joined: Fri Aug 29, 2003 11:09 pm
Posts: 2425
Location: Earth
The department of information blah blah blah at the University of Lisbon. Definitely a mouthful.

This is totally off-topic but one of the interesting things about the Portugese is they have really long names. I was flying with an elderly Portugese woman as my seatmate, and my heart went out to her as she tried to write her name in the rediculously small space on the green customs form.

David

_________________
Join SPCR's Folding Team! <-- Click Here


Last edited by haysdb on Fri Apr 09, 2004 1:44 am, edited 1 time in total.

Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 1:37 am 
Offline
Patron of SPCR

Joined: Thu Apr 10, 2003 1:56 am
Posts: 316
foldingteams-suck

They were kicked out of other teams.

_________________
XP 2800@2270mhz+SLK800A+Nexus fan, Aopen 8RDA+@414mhz, Samsung 80gb on foam, XFX6800GT with a Nexus 120mm fan taped onto it, Nexus 4090 PSU, Chieftec Dragon+Nexus fan@1200rpm


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 5:02 am 
Offline
*Lifetime Patron*

Joined: Wed Nov 12, 2003 10:06 am
Posts: 3214
Location: Pittsburgh, PA
haysdb wrote:
This is totally off-topic but one of the interesting things about the Portugese is they have really long names. I was flying with an elderly Portugese woman as my seatmate, and my heart went out to her as she tried to write her name in the rediculously small space on the green customs form.

You know, I've always thought the same thing about the Thai. With the added bonus that a good deal of Thai names look unpronouncable to the western world.

_________________
My Power Rig, Storage Rig, HTPC and Main Rig


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 6:29 am 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Quote:
names look unpronouncable to the western world

You mean like this one? :)

sthayashi

M


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 7:24 am 
Offline
*Lifetime Patron*

Joined: Wed Nov 12, 2003 10:06 am
Posts: 3214
Location: Pittsburgh, PA
mas92264 wrote:
Quote:
names look unpronouncable to the western world

You mean like this one? :)

sthayashi

M

Yup... But since my user name is derived from my first initial, middle initial, and last name, it may become easier to pronounce if you read it like I do, S T Hayashi. Of course, Japanese names seem to be pretty difficult to pronounce in the western world too.... I've had people ask me how to pronounce Masayoshi or Teriyuki.

But to me, names like Supsampantuwongse or Jatukamramthep are more intimidating. But then again, Thai names don't hold a candle to Welsh locations. I can't even take a stab at pronouncing the village of Dwygyfylchi (a real village!!). And at least Thai names don't require special characters to write in English, unlike the African name, N!xau (from the "Gods Must Be Crazy").

I didn't mean to rant on Thai names though (or any other names for that matter), just wanted to point out that they have the longest names I've ever encountered. Supposedly, the full name for Bangkok is the longest location name in the world, Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit.

Though this might considered equivalent to the famous American city, "El Pueblo del la Reina de Los Angeles"

Edited: Corrected the spelling and readibility

_________________
My Power Rig, Storage Rig, HTPC and Main Rig


Last edited by sthayashi on Fri Apr 09, 2004 7:59 am, edited 1 time in total.

Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 7:41 am 
Offline

Joined: Sat Oct 04, 2003 1:43 am
Posts: 187
Location: Madrid, Spain
haysdb wrote:
The department of information blah blah blah at the University of Lisbon.

David


Actually, it means: "Computer Science department of Science's Faculty at the University of Lisbon" :lol: You should have studied Portuguese harder while you were living there David :P

BTW, I study at:

"Escuela Técnica Superior de Ingenieros de Telecomunicacion" (ETSIT) at the "Universidad Politécnica de Madrid"(UPM) Even this names are too long for us. I'll let David the translation :P or if you really want to know I'll tell you.

Long names seems common to many Latin languages.
:lol:

_________________
Athlon XP 2500 (Barton), Gigabyte GA-7VAX, Kingston 512MB DDR333, Samsung SP1213N (120GB), Geforce 2 MX 200, Case Aopen H500, Zalman 6000Cu, Antec TruePower 330.
Image


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 7:51 am 
Offline

Joined: Sat Oct 04, 2003 1:43 am
Posts: 187
Location: Madrid, Spain
Bangkok real name is really awesome, but I think the longest location name belongs to a town in Scotland, and it's a gaelic name, I don't remember the name of course, but I remember that it appeared on TV some time ago

_________________
Athlon XP 2500 (Barton), Gigabyte GA-7VAX, Kingston 512MB DDR333, Samsung SP1213N (120GB), Geforce 2 MX 200, Case Aopen H500, Zalman 6000Cu, Antec TruePower 330.
Image


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 8:10 am 
Offline
*Lifetime Patron*

Joined: Wed Nov 12, 2003 10:06 am
Posts: 3214
Location: Pittsburgh, PA
mormakil wrote:
Bangkok real name is really awesome, but I think the longest location name belongs to a town in Scotland, and it's a gaelic name, I don't remember the name of course, but I remember that it appeared on TV some time ago

There's a WELSH town that's pretty long.

But there's a hill in New Zealand that has a longer name than the Welsh town. That's often the one listed in Guinness.

Finally, for us North Americans, there's a lake in Massachusetts that is pretty long (Incidentally, MA is pretty damn unpronouncable for non-English readers).

_________________
My Power Rig, Storage Rig, HTPC and Main Rig


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 8:17 am 
Offline
Patron of SPCR

Joined: Wed May 28, 2003 10:50 am
Posts: 1642
Location: Somewhere out there
It's in Wales, and the name is Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, which means "St. Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of St. Tysilio near the red cave."

Google is a great time waster :-)

http://www.facstaff.bucknell.edu/rbeard/name.html

Edit : sthayashi beat me to the "submit" button. BTW I never would have thought "sthayashi" = "s t hayashi". Initially I thought it looked Indian (as in Asia), then when you mentioned Thai I thought "oh, that must be it" :-)


Top
 Profile  
 
 Post subject:
PostPosted: Fri Apr 09, 2004 4:18 pm 
Offline
Patron of SPCR

Joined: Fri Aug 29, 2003 11:09 pm
Posts: 2425
Location: Earth
mormakil wrote:
haysdb wrote:
The department of information blah blah blah at the University of Lisbon.

David

Actually, it means: "Computer Science department of Science's Faculty at the University of Lisbon" :lol: You should have studied Portuguese harder while you were living there David :P

:oops:

David

_________________
Join SPCR's Folding Team! <-- Click Here


Top
 Profile  
 
 Post subject:
PostPosted: Sat Apr 10, 2004 6:06 am 
Offline
Patron of SPCR

Joined: Fri Sep 26, 2003 5:26 pm
Posts: 659
Location: Palm Springs, CA, USA
Here's a nice one to start off Saturday morning:

skyvu

And, for something that's more business oriented: :)

canned polar bear

M


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 29 posts ] 

All times are UTC - 8 hours


Who is online

Users browsing this forum: No registered users and 2 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group