Funky SPCR User Names

mas92264 · Post by **mas92264** » Wed Apr 07, 2004 9:00 pm

Ok, so this doesn't have much to do with folding, but what the heck.

As I was logging off, I noticed a new user and remembered some other amusing user names. Most, like mine, are kinda boring and of course there are the confusing ones that seem to be some kind of code - like xqzw3&>f which are non-sensical and I have to cut and paste them if I want to reply with their name.

Anyway, a couple of my favorites are:

Beandip

Burnin' Luv

M

Stevo@ARM · Post by **Stevo@ARM** » Wed Apr 07, 2004 11:58 pm

mas92264 wrote:....

Anyway, a couple of my favorites are:

Beandip

Burnin' Luv

M

Well... he's in our SPCR folding forums enough lately, he ought to just give in and start foldin' for us anyway and be done with it.

So for wackiest handle @ SPCR my nominee is ... drumroll....

Macaholic

cause he sure must be drunk on somethin' ... that's right it's pure 180 proof egohol made from fermented apples no less

But seriously folks Macaholic grows on you over time, sort of like a mole with an extra long wiry hair growing out of it... you know... gives the place some unique character don't ya think

Stevo
----------
Some folks said Macaholic SPCR is the place you ought'a be... So he folded up his Mac and crashed our par-ty...

haysdb · Post by **haysdb** » Thu Apr 08, 2004 12:20 am

Stevo, that's really hard to sing.

There are some goofy team names too:

LITTLEWHITEDOG
Team Banana
RamblingWaffles (this pne gets my vote)
Abazaba
Alien Soup
Nerds for Jesus
Dead Men Folding
Wisconsin Wireless Wizards (very clever)
PEBCAK ID1OT

David

mas92264 · Post by **mas92264** » Thu Apr 08, 2004 12:38 am

TacoBellDog

haysdb · Post by **haysdb** » Thu Apr 08, 2004 12:39 am

mas92264 wrote:TacoBellDog

Definitely

mas92264 · Post by **mas92264** » Thu Apr 08, 2004 12:58 am

it's pure 180 proof egohol made from fermented apples no less

Very good, DH.

Egohol.

Too funny!

M

unregistered · Post by **unregistered** » Thu Apr 08, 2004 8:45 am

twodeadfish

funniest I've seen a new folder for teammacosx peterhunter

sbabb · Post by **sbabb** » Thu Apr 08, 2004 10:01 am

haysdb wrote:There are some goofy team names too:
...
PEBCAK ID1OT

PEBCAK is one of my favorite troubleshooting acronyms from my old help-desk days: Problem Exists Between Chair And Keyboard. (Actually we had it as PEBKAC, but the "problem" stays in the same spot.) It was one we could throw at a luser and even after we expanded the acronym most of them didn't get it.

How about these teams:

CPUniCycles (A balanced approach to folding?)
Folding Anarchy (Isn't a team of anarchists an oxymoron?)
The Musers' Idle Thoughts (I think these guys are playing at Axis in Boston this weekend.)
Team Monkeys, Midgets, & Zombies (We all know the dangers of letting these three get together!)
Processor Liberation Organization (Arafat goes cyber!)
Protein Origami Masters (I think they worship Ralf Hutter.)
Box Office Prophets (They warned us about Gigli but we didn't listen.)
Czech Republic (The whole country?!?)
SystemCooling Crunchin Critters (Hmmm. Never considered the possibilities of organic CPU cooling.)
Dean For America (Maybe he should have spent more time campaigning and less time folding?)
Crowbar Swinging Idiots (The obvious solution to the Monkeys, Midgets, & Zombies problem.)
Digital Doritos (Crunch all you want, we'll fold more.)
The Flaming Chickens (Never mind the racket, that's going to smell really bad.)
Microsoft (In the 395th position? You'd think they'd either do better or sue the people who stole their name.)
Raining Squirrels (A decent rain of squirrels should put out the flaming chickens. At least we can hope.)
Pridemark Paramedics ("No, don't defibrilate him now, wait until my WU finishes!")
Milla Jovovich Fans (Uh, oh. That's gonna give GamingGod "an idea.")

Scott (obviously off my meds today)

mas92264 · Post by **mas92264** » Thu Apr 08, 2004 10:34 am

PEBCAK is one of my favorite troubleshooting acronyms from my old help-desk days: Problem Exists Between Chair And Keyboard

I'm glad to see what this means - was totally lost. My implementation of this one is "loose screw near the kybrd." I like PEBCAK better.

M

NoahJ · Post by **NoahJ** » Thu Apr 08, 2004 11:45 am

One of my personal favorites is:

We've got a serious 12 o'clock flasher here.... Every clock in his house is flashing 12:00....

Zyzzyx · Post by **Zyzzyx** » Thu Apr 08, 2004 12:48 pm

And then there's the freaks who try to avoid the common vowels in their name.

Zyzzyx

I mean, would ya look at that idiocy!

peteamer · Post by **peteamer** » Thu Apr 08, 2004 2:22 pm

Good point Zy, however...the ones that really get my goat.../sheep

are the unimaginative ones like... bill_amer

pete_amer (friend_of_john_hooker)

folding_for_SPCR.

Macaholic · Post by **Macaholic** » Thu Apr 08, 2004 2:45 pm

cause he sure must be drunk on somethin' ... that's right it's pure 180 proof egohol made from fermented apples no less

"Ye have heard that it hath been said, An eye for an eye, and a
tooth for a tooth:

But I say unto you, That ye resist not evil: but whosoever
shall smite thee on thy right cheek, turn to him the other
also.

And if any man will sue thee at the law, and take away thy
coat, let him have thy cloak also.

And whosoever shall compel thee to go a mile, go with him
twain."

mas92264 · Post by **mas92264** » Thu Apr 08, 2004 3:00 pm

We've got a serious 12 o'clock flasher here.... Every clock in his house is flashing 12:00....

Or the similar and equally descriptive "some of her dogs aren't barking."

M

Stevo@ARM · Post by **Stevo@ARM** » Thu Apr 08, 2004 3:49 pm

Macaholic wrote:
"Ye have heard that it hath been said, An eye for an eye, and a
tooth for a tooth:

But I say unto you, That ye resist not evil: but whosoever
shall smite thee on thy right cheek, turn to him the other
also.

And if any man will sue thee at the law, and take away thy
coat, let him have thy cloak also.

And whosoever shall compel thee to go a mile, go with him
twain."

Excellent comeback Macaholic

Now you should know, I am certainly not going to argue with the good book.

"a soft answer turneth away wrath"

And hey, we've been having fun swapping jabs lately, but for what it's worth, you and NoahJ and your other team members have all made folding a heck of a lot more exciting for both Roy and myself and many of our fellow SPCR team members as well. I hope we have put a bit more fun into your folding efforts too.

As for our friendly cross-town rivalry our teams will will certainly play again just a little later in the season. Your current massive new membership influx has put you guys into hyper-space. We will continue building the team one solid loyal folder at a time though, and at some point when your warp engines need some refueling we'll certainly be there to liven things up again for the playoffs.

I tip my hat to you and NoahJ and everyone else at Team MacOS X. For though we may be friendly competitors, I must say I am truly impressed with both your personal folding points production, and the awesome PR job NoahJ put together with Apple that pushed your team into Warp-drive.

Goals are a good thing, and I am actually glad your team has raised the bar so high. Our team needs to build up some more folding muscle and your team's recent achievements have proven just what can be accomplished.

Stevo
--------------
Fold on Macaholic, 'cause this folding gorilla is going to eat some more bananas to bulk up before our next game

NoahJ · Post by **NoahJ** » Thu Apr 08, 2004 4:26 pm

Thanks Stevo! If we meet again it should be in the top 15 playoffs.. Maybe even the top 10....

unregistered · Post by **unregistered** » Thu Apr 08, 2004 4:27 pm

That reminds me there is also this team name

http://folding.extremeoverclocking.com/ ... s=&t=11195

Stevo@ARM · Post by **Stevo@ARM** » Thu Apr 08, 2004 11:58 pm

haysdb wrote:There are some goofy team names too....

Add this one to the list:

Departamento de Informática da Faculdade de Ciências da Universidade de Lisboa

In about 600th place at the moment
http://folding.extremeoverclocking.com/ ... s=&t=34093

Stevo
-------------
And you thought I had a long team name

haysdb · Post by **haysdb** » Fri Apr 09, 2004 12:33 am

The department of information blah blah blah at the University of Lisbon. Definitely a mouthful.

This is totally off-topic but one of the interesting things about the Portugese is they have really long names. I was flying with an elderly Portugese woman as my seatmate, and my heart went out to her as she tried to write her name in the rediculously small space on the green customs form.

David

Wrah · Post by **Wrah** » Fri Apr 09, 2004 1:37 am

foldingteams-suck

They were kicked out of other teams.

sthayashi · Post by **sthayashi** » Fri Apr 09, 2004 5:02 am

haysdb wrote:This is totally off-topic but one of the interesting things about the Portugese is they have really long names. I was flying with an elderly Portugese woman as my seatmate, and my heart went out to her as she tried to write her name in the rediculously small space on the green customs form.

You know, I've always thought the same thing about the Thai. With the added bonus that a good deal of Thai names look unpronouncable to the western world.

mas92264 · Post by **mas92264** » Fri Apr 09, 2004 6:29 am

names look unpronouncable to the western world

You mean like this one?

sthayashi

M

sthayashi · Post by **sthayashi** » Fri Apr 09, 2004 7:24 am

mas92264 wrote:
names look unpronouncable to the western world
You mean like this one?

sthayashi

M

Yup... But since my user name is derived from my first initial, middle initial, and last name, it may become easier to pronounce if you read it like I do, S T Hayashi. Of course, Japanese names seem to be pretty difficult to pronounce in the western world too.... I've had people ask me how to pronounce Masayoshi or Teriyuki.

But to me, names like Supsampantuwongse or Jatukamramthep are more intimidating. But then again, Thai names don't hold a candle to Welsh locations. I can't even take a stab at pronouncing the village of Dwygyfylchi (a real village!!). And at least Thai names don't require special characters to write in English, unlike the African name, N!xau (from the "Gods Must Be Crazy").

I didn't mean to rant on Thai names though (or any other names for that matter), just wanted to point out that they have the longest names I've ever encountered. Supposedly, the full name for Bangkok is the longest location name in the world, Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit.

Though this might considered equivalent to the famous American city, "El Pueblo del la Reina de Los Angeles"

Edited: Corrected the spelling and readibility

mormakil · Post by **mormakil** » Fri Apr 09, 2004 7:41 am

haysdb wrote:The department of information blah blah blah at the University of Lisbon.

David

Actually, it means: "Computer Science department of Science's Faculty at the University of Lisbon"

You should have studied Portuguese harder while you were living there David

BTW, I study at:

"Escuela Técnica Superior de Ingenieros de Telecomunicacion" (ETSIT) at the "Universidad Politécnica de Madrid"(UPM) Even this names are too long for us. I'll let David the translation

or if you really want to know I'll tell you.

Long names seems common to many Latin languages.

mormakil · Post by **mormakil** » Fri Apr 09, 2004 7:51 am

Bangkok real name is really awesome, but I think the longest location name belongs to a town in Scotland, and it's a gaelic name, I don't remember the name of course, but I remember that it appeared on TV some time ago

sthayashi · Post by **sthayashi** » Fri Apr 09, 2004 8:10 am

mormakil wrote:Bangkok real name is really awesome, but I think the longest location name belongs to a town in Scotland, and it's a gaelic name, I don't remember the name of course, but I remember that it appeared on TV some time ago

There's a WELSH town that's pretty long.

But there's a hill in New Zealand that has a longer name than the Welsh town. That's often the one listed in Guinness.

Finally, for us North Americans, there's a lake in Massachusetts that is pretty long (Incidentally, MA is pretty damn unpronouncable for non-English readers).

lenny · Post by **lenny** » Fri Apr 09, 2004 8:17 am

It's in Wales, and the name is Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, which means "St. Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of St. Tysilio near the red cave."

Google is a great time waster

http://www.facstaff.bucknell.edu/rbeard/name.html

Edit : sthayashi beat me to the "submit" button. BTW I never would have thought "sthayashi" = "s t hayashi". Initially I thought it looked Indian (as in Asia), then when you mentioned Thai I thought "oh, that must be it"

haysdb · Post by **haysdb** » Fri Apr 09, 2004 4:18 pm

mormakil wrote:
haysdb wrote:The department of information blah blah blah at the University of Lisbon.

David
Actually, it means: "Computer Science department of Science's Faculty at the University of Lisbon" You should have studied Portuguese harder while you were living there David

David

mas92264 · Post by **mas92264** » Sat Apr 10, 2004 6:06 am

Here's a nice one to start off Saturday morning:

skyvu

And, for something that's more business oriented:

canned polar bear

M

Funky SPCR User Names

Funky SPCR User Names

Re: Funky SPCR User Names